Web stats for Cctvsecurityservices - cctvsecurityservices.in
Best CCTV Installation in Delhi NCR Noida. Divine Soft provides complete electronic security services in Gurgaon, Noida, Faridabad & Delhi NCR. Buy CCTV security camera system for home, kids and office surveillance.
2.20 Rating by ClearWebStats
This website is a sub-domain of in. This website has a #12,781,893 rank in global traffic. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. Additionally, the website is monetizing using Adsense. While no active threats were reported recently by users, cctvsecurityservices.in is SAFE to browse.
Traffic Report of Cctvsecurityservices
Daily Unique Visitors: | 38 |
Daily Pageviews: | 76 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 12,781,893 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
45
Siteadvisor Rating
Not Applicable
Where is cctvsecurityservices.in server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 3 |
H3 Headings: | 11 | H4 Headings: | 2 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 16 |
Google Adsense: | pub-2253449323892526 | Google Analytics: | UA-133010694-1 |
Websites Hosted on Same IP (i.e. 162.241.148.33)
Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute
- shrivishwakarmasafetytraininginstitute.com
The Shine English Academy – DREAM | LEARN | SPEAK
- theshineenglishacademy.com
Urvashi International Packers and Movers|Movers and Packers Hyderabad
- urvashiinternationalpackers.com
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
- 247bestpillpharma.com
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Sat, 01 Jun 2019 15:05:36 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/5.6.40
Link: <http://www.cctvsecurityservices.in/wp-json/>; rel="https://api.w.org/", <http://www.cctvsecurityservices.in/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Date: Sat, 01 Jun 2019 15:05:36 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/5.6.40
Link: <http://www.cctvsecurityservices.in/wp-json/>; rel="https://api.w.org/", <http://www.cctvsecurityservices.in/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
cctvsecurityservices.in | A | 14400 |
IP:162.241.148.33 |
cctvsecurityservices.in | NS | 86400 |
Target:ns1.bh-ht-17.webhostbox.net |
cctvsecurityservices.in | NS | 86400 |
Target:ns2.bh-ht-17.webhostbox.net |
cctvsecurityservices.in | SOA | 10800 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:cpanel.webhostbox.net Serial:2019040803 Refresh:86400 Retry:7200 Expire:3600000 |
cctvsecurityservices.in | MX | 14400 |
Target:cctvsecurityservices.in |
Similarly Ranked Websites to Cctvsecurityservices
Party entertainers | children's party entertainers | mobile disco's
- theperfectpartypeople.co.uk
Birthday party entertainer's from "The Perfect Party People". Childrens entertainers and professional disco entertainment.
North Georgia RV Storage of Ringgold
- ngarvstorage.com
Specializing in indoor storage and care of your RV, jet ski, boat, classic car. Located in Ringgold, Georgia, near Chattanooga, Ft. Oglethorpe, Dalton, and LaFayette.